PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G255100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 298aa    MW: 32327.7 Da    PI: 8.1242
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G255100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+llvd+++  G g+W++ ++  g++R++k+c++rw +yl
  Sevir.1G255100.1.p 15 KGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 62
                        79********************************************97 PP

2Myb_DNA-binding51.13.1e-1668113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ +v++++  G++ W+ Ia+ ++ gRt++++k++w+++l
  Sevir.1G255100.1.p  68 RGPFSPEEQKSIVQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 113
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0191062IPR017930Myb domain
SuperFamilySSF466893.07E-3112109IPR009057Homeodomain-like
SMARTSM007173.7E-141464IPR001005SANT/Myb domain
PfamPF002491.9E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231669IPR009057Homeodomain-like
CDDcd001679.63E-101762No hitNo description
PROSITE profilePS5129426.02863117IPR017930Myb domain
SMARTSM007175.9E-1567115IPR001005SANT/Myb domain
PfamPF002491.9E-1468113IPR001005SANT/Myb domain
CDDcd001673.61E-1070113No hitNo description
Gene3DG3DSA:1.10.10.607.1E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRAPCCDRT KGLKKGPWTP EEDKLLVDYI QANGHGSWRL LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGP FSPEEQKSIV QLHAIVGNKW SMIAAQLPGR TDNEIKNYWN THLKKQLRRM  120
GLDEPPPGPA AGCPAARHMA QWETARLEAE ARLSLLASSC SSGATATTAT TSASSSSTFA  180
AGAEKASSKP ADIFLRLWSS DIGDSFRRKT AAPALPAPPV KRKDDVVMIK QEALALPAPG  240
DDSSAASNET EVAEALEEYQ MFLDFAGEEL GLFHGRYGGF SLFPPLEVLE ASLDTAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27131175108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0660050.0BT066005.1 Zea mays full-length cDNA clone ZM_BFb0144N05 mRNA, complete cds.
GenBankKJ7269000.0KJ726900.1 Zea mays clone pUT3445 MYB transcription factor (MYB89) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953258.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK3YUI80.0K3YUI8_SETIT; Uncharacterized protein
STRINGSi017934m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.16e-74myb domain protein 17